Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!

Alpha Synuclein S129A Mutant Pre-formed Fibrils

Alpha Synuclein S129A Mutant Pre-formed Fibrils

CAT#: PFF-S006

Inquiry

Overview Specification

Species	Human
Tag	Tag Free
Expression Systems	E.coli
Keywords	Preformed fibrils

Synonyms	Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein S129A
Background	Elevated levels of phosphoserine 129 (pS129) on alpha-synuclein have long been considered a hallmark of Parkinson’s disease and other synucleinopathies, where up to 90% of alpha-synuclein deposition in Lewy Bodies contains pS129, compared to ≤4% in normal brains. Further, pS129 was recently shown to function as a physiological regulator of neuronal activity. Alpha-synuclein S129A monomers and fibrils cannot be phosphorylated at position 129 and therefore can be utilized to study phospho-S129-independent biology and pathology. Further, this material can be used to confirm the induction of endogenous pS129 pathology in disease models.
Description	Human Recombinant Alpha Synuclein S129A Mutant Pre-formed Fibrils
SWISS	P37840-1
Amino Acid Sequence	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA
Protein Length	Full length (1 - 140 aa)
Applications	WB, SDS PAGE, In vitro assay
Research Areas	Alzheimer's Disease, Neurodegeneration, Neuroscience, Parkinson's Disease, Synuclein, Tangles & Tau, Multiple System Atrophy
Concentration	Lot/batch specific. See included datasheet.
Nature	Recombinant
Storage Buffer	1X PBS pH 7.4
Purity	>95%
Purification	Ion-exchange Purified
Storage	Stored at -80°C
Shipping	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Notes	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.

All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Online Inquiry

Alfa Cytology provides its clients with one-stop solutions to accelerate therapeutic discovery and development of brain tumors.

By Disease

Craniopharyngioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.