Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!

Alpha Synuclein S87N Mutant Pre-formed Fibrils

Alpha Synuclein S87N Mutant Pre-formed Fibrils

CAT#: PFF-S005

Inquiry

Overview Specification

Species	Human
Tag	Tag Free
Expression Systems	E.coli
Keywords	Preformed fibrils

Synonyms	MAPT, 2N4R, Tau40 neurofibrillary tangle protein, paired-helical filament, PHFs, SNCA, NACP, PARK1, asyn, alpha-synuclein, pre-formed fibril, PFFs, mixed fibrils
Background	Human alpha-synuclein S87N mutant (HuS87N) has Ser87 mutated to the equivalent mouse residue Asn87, effectively making it a human-mouse chimeric protein. Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse α-syn (MsWT) is faster than wild-type human α-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing endogenous mouse α-syn pathology. A53T or S87N substitutions in human α-syn substantially accelerate fibrilization rates in vitro. Chimeric HuS87N fibrils show enhanced induction of α-syn pathology greater than both HuWT and MsWT fibrils in mice neuron cultures. Therefore, HuS87N is a good construct for inducing robust endogenous α-syn seeding and pathology in wild-type mice/cultures.
Description	Human Recombinant Alpha Synuclein S87N Mutant Pre-formed Fibrils
SWISS	P37840-1
Accession Number	NP_000336.1
Gene ID	6622
Amino Acid Sequence	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Protein Length	140 aa
Applications	WB, SDS PAGE, In vitro assay
Research Areas	Alzheimer's Disease, Neurodegeneration, Neuroscience, Parkinson's Disease, Synuclein, Tangles & Tau, Multiple System Atrophy
Concentration	Lot/batch specific. See included datasheet.
Nature	Recombinant
Storage Buffer	1X PBS pH 7.4
Purity	>95%
Purification	Ion-exchange Purified
Storage	Stored at -80°C
Shipping	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Notes	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.

All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Online Inquiry

Alfa Cytology provides its clients with one-stop solutions to accelerate therapeutic discovery and development of brain tumors.

By Disease

Craniopharyngioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.