Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!

Learn More
Alfa Cytology/Brain Tumors Alfa Cytology/Brain Tumors
Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils

Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils

CAT#: PFF-S010

Inquiry
Overview Specification
Species Human
Tag Tag Free
Expression Systems E.coli
Keywords Preformed fibrils
Synonyms Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein TNG
Background Human alpha-synuclein TNG mutant (HuTNG) is a triple mutant containing Ala53 mutated to the equivalent mouse residue Thr53, Ser87 mutated to the equivalent mouse residue Asn87, and Asn103 mutated to the equivalent mouse residue Gly103, effectively making it a human-mouse chimeric protein. A53T or S87N substitutions in human α-syn substantially accelerate fibrilization rates in vitro. Chimeric HuTNG fibrils show enhanced induction of α-syn pathology greater than both HuWT and MsWT fibrils after a single unilateral injection into the dorsal striatum in mice. Therefore, HuTNG is a good construct for inducing robust endogenous α-syn seeding and pathology in wild-type mice.
Description Human Recombinant Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils
SWISS P37840-1
Amino Acid Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKGEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Protein Length Full length (1 - 140 aa)
Applications WB, SDS PAGE, In vitro assay
Research Areas Alzheimer's Disease, Neurodegeneration, Neuroscience, Parkinson's Disease, Synuclein, Tangles & Tau, Multiple System Atrophy
Concentration Lot/batch specific. See included datasheet.
Nature Recombinant
Storage Buffer 1X PBS pH 7.4
Purity >95%
Purification Ion-exchange Purified
Storage Stored at -80°C
Shipping Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Notes Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
Related Products
Immune Checkpoint Proteins CAR-T Target Proteins Antibodies for Glioma Classification Neuroscience Research ELISA Kits Neural Stem Cell and Progenitor Markers Neural Markers Astrocyte Markers Oligodendrocyte Markers Extraction Kits for Brain Tumors Research In Vitro Diagnostic Proteins Neural Recombinant Proteins Pre-Formed Fibrils Test Kits for Brain Tumors-Related Assays
Online Inquiry
By Disease

Glioma

Craniopharyngioma

Meningioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Gene Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.