Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!

Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)

Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)

CAT#: PFF-S030

Inquiry

Overview Specification

Species	Human
Tag	ATTO 594
Expression Systems	E.coli
Keywords	Preformed fibrils

Synonyms	Alpha synuclein PFFs, Alpha synuclein aggregates, Alpha synuclein PFF, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha synuclein protein seed, ATTO 594 conjugated alpha synuclein, ATTO labelled alpha synuclein fibrils
Background	Alpha-synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals. Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum, and thalamus. Functionally, it has been shown to significantly interact with tubulin and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of cognitive functions; inactivation may lead to impaired spatial learning and working memory. SNCA fibrillar aggregates represent the major non-A-beta component of Alzheimer's disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin.
Description	Alpha Synuclein Protein
SWISS	P37840
Accession Number	NP_000336.1
Gene ID	6622
Cellular Localization	Cytoplasm, Membrane, Nucleus
Amino Acid Sequence	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAG
Applications	WB, SDS-PAGE, In vivo assay, In vitro assay
Research Areas	Alzheimer's Disease, Neurodegeneration, Neuroscience, Parkinson's Disease, Synuclein, Tangles & Tau, Multiple System Atrophy
Concentration	Lot/batch specific. See included datasheet.
Nature	Recombinant
Biological Activity	Under Investigation
Storage Buffer	PBS pH 7.4, 0.09% Azide
Purity	>95%
Purification	Ion-exchange Purified
Storage	Stored at -80°C
Shipping	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Notes	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.

All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Online Inquiry

Alfa Cytology provides its clients with one-stop solutions to accelerate therapeutic discovery and development of brain tumors.

By Disease

Craniopharyngioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.