Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!

Human Recombinant Tau-352 (fetal 0N3R) Wild-Type Pre-formed Fibrils

Human Recombinant Tau-352 (fetal 0N3R) Wild-Type Pre-formed Fibrils

CAT#: PFF-S029

Inquiry

Overview Specification

Species	Human
Tag	Tag Free
Expression Systems	E.coli
Keywords	Preformed fibrils

Synonyms	Tau aggregate, tau protein, microtubule-associated protein tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Aggregate, Paired Helical Filament- Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, 95-amino acid tau protein fragment, Truncated Tau
Background	Alzheimer’s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65. Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing paired helical filaments (PHFs). Brain-specific tau isoforms vary in the number of N-terminal inserts and C-terminal repeat domains due to alternative splicing of exons; only the shortest isoform of tau, 0N3R, is expressed in the fetal brain during neurogenesis. Three-repeat (3R) isoforms are more prone than four-repeat (4R) isoforms to form oligomers in vitro. The β-sheet core of Tau 0N3R fibrilized using heparin differs from all other tau fibril structures known to date.
Description	Tau Protein
SWISS	P10636-2
Accession Number	NP_058525.1
Gene ID	4137
Cellular Localization	Axolemma, Axolemma Plasma Membrane, Axon, Cell Body, Cell membrane, Cytoplasm, Cytoplasmic Ribonucleoprotein Granule, Cytoplasmic Side, Cytoskeleton, Cytosol, Dendrite, Growth cone, Microtubule, Microtubule Associated Complex, Neurofibrillary Tangle, Neuronal Cell Body, Nuclear Periphery, Nuclear Speck, Nucleus, Peripheral membrane protein, Plasma Membrane, Tubulin Complex
Amino Acid Sequence	MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Protein Length	Full length (1-352 aa)
Applications	WB, SDS PAGE, In vitro assay
Research Areas	Alzheimer's Disease, Axon Markers, Cell Markers, Cell Signaling, Cytoskeleton, Microtubules, MT Associated Proteins, Neurodegeneration, Neuron Markers, Neuroscience, Tangles & Tau
Concentration	Lot/batch specific. See included datasheet.
Nature	Recombinant
Storage Buffer	10 mM Hepes pH 7.4, 100 mM NaCl
Purity	>95%
Purification	Ion-exchange Purified
Storage	Stored at -80°C
Shipping	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Notes	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.

All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Online Inquiry

Alfa Cytology provides its clients with one-stop solutions to accelerate therapeutic discovery and development of brain tumors.

By Disease

Craniopharyngioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.