Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!

Learn More
Alfa Cytology/Brain Tumors Alfa Cytology/Brain Tumors
Human Recombinant Tau-441 (2N4R) and Human Recombinant Alpha Synuclein Co-Polymer Fibrils

Human Recombinant Tau-441 (2N4R) and Human Recombinant Alpha Synuclein Co-Polymer Fibrils

CAT#: PFF-S012

Inquiry
Overview Specification
Species Human
Tag Tag Free
Expression Systems E.coli
Keywords Preformed fibrils
Synonyms MAPT, 2N4R, Tau40 neurofibrillary tangle protein, paired-helical filament, PHFs, SNCA, NACP, PARK1, asyn, alpha-synuclein, pre-formed fibril, PFFs, mixed fibrils
Background Brain-specific tau isoforms vary in the number of N-terminal inserts and C-terminal repeat domains due to alternative splicing of exons; the 2N4R isoform of tau is expressed in the adult brain yet is absent from the fetal brain. Tau and alpha-synuclein polymerize into amyloid fibrils to form filamentous inclusions in neurodegenerative diseases such as Alzheimer’s and Parkinson’s. Tau has been shown to interact with alpha-synuclein in vitro, with synergistic cross-seeding between tau and alpha-synuclein resulting in the polymerization of each other into fibrillary amyloid lesions in neuronal cultures and in vivo. Recombinant tau and alpha-synuclein co-polymer fibrils have demonstrated a more widespread transmission of induced pathology in a rodent model of tauopathies compared to pure Tau or alpha-synuclein fibrils alone. These co-polymer fibrils have also shown enhanced alpha-synuclein aggregation in vitro, and more severe alpha-synuclein pathology and Parkinson’s disease-like symptoms in mice.
Description Tau and Alpha Synuclein Co-Polymer Fibrils
SWISS P10636-8, P37840-1
Amino Acid Sequence Tau:
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

Asyn:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Protein Length Full length (Tau 2N4R: 1-441 aa, ASYN: 1-140 aa)
Applications WB, SDS PAGE, In vitro assay
Research Areas Alzheimer's Disease, Neurodegeneration, Neuroscience, Parkinson's Disease, Synuclein, Tangles & Tau, Multiple System Atrophy
Concentration 2 mg/ml (1 mg/ml of tau and 1 mg/ml of aSyn)
Nature Recombinant
Storage Buffer 1X PBS pH 7.4
Purity >95%
Purification Ion-exchange Purified
Storage Stored at -80°C
Shipping Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Notes Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
Related Products
Immune Checkpoint Proteins CAR-T Target Proteins Antibodies for Glioma Classification Neuroscience Research ELISA Kits Neural Stem Cell and Progenitor Markers Neural Markers Astrocyte Markers Oligodendrocyte Markers Extraction Kits for Brain Tumors Research In Vitro Diagnostic Proteins Neural Recombinant Proteins Pre-Formed Fibrils Test Kits for Brain Tumors-Related Assays
Online Inquiry
By Disease

Glioma

Craniopharyngioma

Meningioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Gene Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.