Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!
Learn MoreCAT#: PFF-S019
Species | Human |
Tag | Tag Free |
Expression Systems | E.coli |
Keywords | Preformed fibrils |
Synonyms | Tau PFFs, Tau PFF, Tau protein Pre-formed Fibrils, Tau aggregates, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 4, tubulin-associated unit, MAPT DeltaK280, K280 deletion Tau, K18 delta K280 Tau, truncated delta K280 Tau |
Background | Alzheimer’s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65. Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. The ΔK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers. K18 is a truncated form of human tau containing only the 4 microtubule-binding repeats. |
Description | Tau Protein |
SWISS | P10636 |
Gene ID | 4137 |
Cellular Localization | Axolemma, Axolemma Plasma Membrane, Axon, Cell Body, Cell membrane, Cytoplasm, Cytoplasmic Ribonucleoprotein Granule, Cytoplasmic Side, Cytoskeleton, Cytosol, Dendrite, Growth cone, Microtubule, Microtubule Associated Complex, Neurofibrillary Tangle, Neuronal Cell Body, Nuclear Periphery, Nuclear Speck, Nucleus, Peripheral membrane protein, Plasma Membrane, Tubulin Complex |
Amino Acid Sequence | MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE |
Protein Length | Partial |
Applications | WB, SDS-PAGE, In vivo assay, In vitro assay |
Research Areas | Alzheimer's Disease, Axon Markers, Cell Markers, Cell Signaling, Cytoskeleton, Microtubules, MT Associated Proteins, Neurodegeneration, Neuron Markers, Neuroscience, Tangles & Tau |
Concentration | Lot/batch specific. See included datasheet. |
Nature | Recombinant |
Storage Buffer | 1X PBS pH 7.4 |
Purity | >95% |
Purification | Ion-exchange Purified |
Storage | Stored at -80°C |
Shipping | Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order. |
Notes | Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only. |