Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!

Rat Recombinant Alpha Synuclein Protein Monomers

Rat Recombinant Alpha Synuclein Protein Monomers

CAT#: PFF-S013

Inquiry

Overview Specification

Species	Rat
Tag	Tag Free
Expression Systems	E.coli
Keywords	Preformed fibrils

Synonyms	Alpha synuclein pre-formed fibrils, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkison disease familial 1 Protein
Background	Alpha-synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals. Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum, and thalamus. Functionally, it has been shown to significantly interact with tubulin and may serve as a potential microtubule-associated protein. SNCA fibrillar aggregates represent the major non-A-beta component of Alzheimer's disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin. The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha-synuclein fibrillization.
Description	Alpha Synuclein Protein
SWISS	P37377
Accession Number	NP_062042.1
Gene ID	29219
Cellular Localization	Cytoplasm, Membrane, Nucleus
Amino Acid Sequence	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA
Protein Length	Full length
Applications	WB, SDS-PAGE, In vivo assay, In vitro assay
Research Areas	Alzheimer's Disease, Neurodegeneration, Neuroscience, Parkinson's Disease, Synuclein, Tangles & Tau, Multiple System Atrophy
Concentration	Lot/batch specific. See included datasheet.
Nature	Recombinant
Storage Buffer	1X PBS pH 7.4
Purity	>95%
Purification	Ion-exchange Purified
Storage	Stored at -80°C
Shipping	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Notes	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.

All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Online Inquiry

Alfa Cytology provides its clients with one-stop solutions to accelerate therapeutic discovery and development of brain tumors.

By Disease

Craniopharyngioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.