Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!

Learn More
Alfa Cytology/Brain Tumors Alfa Cytology/Brain Tumors
Tau dGAE (297-391) AD-mimic Pre-formed Fibrils

Tau dGAE (297-391) AD-mimic Pre-formed Fibrils

CAT#: PFF-S007

Inquiry
Overview Specification
Species Human
Tag Tag Free
Expression Systems E.coli
Keywords Preformed fibrils
Synonyms Tau aggregate, Tau PFFs, Tau PFF, Tau protein aggregate, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Aggregate, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, dGAE Tau Protein, Tau dGAE
Background Filamentous tau inclusions are a hallmark of many neurodegenerative diseases, including Alzheimer’s disease (AD) and Chronic Traumatic Encephalopathy (CTE), collectively called tauopathies. Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models.
Description Human Recombinant Tau dGAE (297-391) AD-mimic Pre-formed Fibrils (fibrilized without heparin)
SWISS P10636-8
Amino Acid Sequence IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
Protein Length Fragment of full length wild-type Tau 2N4R (297 - 391 aa)
Applications WB, SDS PAGE, In vitro assay
Research Areas Alzheimer's Disease, Axon Markers, Cell Markers, Cell Signaling, Cytoskeleton, Microtubules, MT Associated Proteins, Neurodegeneration, Neuron Markers, Neuroscience, Tangles & Tau
Concentration Lot/batch specific. See included datasheet.
Nature Recombinant
Storage Buffer 10 mM PB pH 7.4, 10 mM DTT, 200 mM MgCl2
Purity >95%
Purification Ion-exchange Purified
Storage Stored at -80°C
Shipping Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Notes Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
Related Products
Immune Checkpoint Proteins CAR-T Target Proteins Antibodies for Glioma Classification Neuroscience Research ELISA Kits Neural Stem Cell and Progenitor Markers Neural Markers Astrocyte Markers Oligodendrocyte Markers Extraction Kits for Brain Tumors Research In Vitro Diagnostic Proteins Neural Recombinant Proteins Pre-Formed Fibrils Test Kits for Brain Tumors-Related Assays
Online Inquiry
By Disease

Glioma

Craniopharyngioma

Meningioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Gene Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.