Meet Alfa Cytology at the Cancer R&D 2024, Nov 18-20, 2024. We look forward to connecting with you and providing expert solutions for your cancer drug development projects.
Learn MoreCAT#: ATB-G003
Unit Size | 100 μl, 25 μl |
Concentration | 0.4 mg/ml |
Availability | >10 in stock |
Recommended Applications | ICC-IF |
Keywords | 100 μl, 25 μl; 0.4 mg/ml; ICC-IF |
Product Description | Polyclonal antibody against human ATRX |
Alternative Gene Names | JMS, MRX52, RAD54, XH2, XNP |
Target Protein | Alpha thalassemia/mental retardation syndrome X-linked |
Target Gene | ATRX |
Antigen Sequence | EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE |
Verified Species Reactivity | Human |
Interspecies Information | Highest antigen sequence identity to the following orthologs: Rat ENSRNOG00000056703 (57%) Mouse ENSMUSG00000031229 (51%) |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Shipping | Normally shipped at ambient temperature. |
Storage | Store at +4℃ for short term storage. Long time storage is recommended at -20℃. |