Meet Alfa Cytology at the Cancer R&D 2024, Nov 18-20, 2024. We look forward to connecting with you and providing expert solutions for your cancer drug development projects.

Polyclonal Anti-GFAP Antibody

Polyclonal Anti-GFAP Antibody

CAT#: ATB-G008

Inquiry

Overview Specification

Unit Size	100 μl
Concentration	0.05 mg/ml
Availability	>10 in stock
Recommended Applications	IHC, WB, ICC-IF
Keywords	100 μl; 0.05 mg/ml; IHC, WB, ICC-IF

Product Description	Polyclonal antibody against human GFAP
Alternative Gene Names	FLJ45472
Target Protein	Glial fibrillary acidic protein
Target Gene	GFAP
Antigen Sequence	LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD
Verified Species Reactivity	Human, mouse
Interspecies Information	Highest antigen sequence identity to the following orthologs: Rat ENSRNOG00000002919 (100%) Mouse ENSMUSG00000020932 (98%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Shipping	Normally shipped at ambient temperature.
Storage	Store at +4℃ for short term storage. Long time storage is recommended at -20℃.

All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Online Inquiry

Alfa Cytology provides its clients with one-stop solutions to accelerate therapeutic discovery and development of brain tumors.

By Disease

Craniopharyngioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.