CAT#: ATB-G006
Unit Size | 100 μl, 25 μl |
Concentration | 0.05 mg/ml |
Availability | >10 in stock |
Recommended Applications | IHC, WB |
Keywords | 100 μl, 25 μl; 0.05 mg/ml; IHC, WB |
Product Description | Polyclonal antibody against human IDH1 |
Target Protein | Isocitrate dehydrogenase 1 (NADP+), soluble |
Target Gene | IDH1 |
Antigen Sequence | LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA |
Verified Species Reactivity | Human |
Interspecies Information | Highest antigen sequence identity to the following orthologs: Rat ENSRNOG00000015020 (95%) Mouse ENSMUSG00000025950 (92%) |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Shipping | Normally shipped at ambient temperature. |
Storage | Store at +4℃ for short term storage. Long time storage is recommended at -20℃. |