Polyclonal Anti-IDH1 Antibody (Validated for IHC, WB, 0.05 mg/ml)

CAT#: ATB-G006

Inquiry
Overview Specification
Unit Size 100 μl, 25 μl
Concentration 0.05 mg/ml
Availability >10 in stock
Recommended Applications IHC, WB
Keywords 100 μl, 25 μl; 0.05 mg/ml; IHC, WB
Product Description Polyclonal antibody against human IDH1
Target Protein Isocitrate dehydrogenase 1 (NADP+), soluble
Target Gene IDH1
Antigen Sequence LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000015020 (95%)
Mouse ENSMUSG00000025950 (92%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Shipping Normally shipped at ambient temperature.
Storage Store at +4℃ for short term storage. Long time storage is recommended at -20℃.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
Online Inquiry