Cancer R&D 2024 has wrapped up successfully. We’re grateful for your interest and interaction with Alfa Cytology. We’re eager to continue providing our expertise in cancer drug development. Let’s look back on these memorable moments!

Polyclonal Anti-IDH1 Antibody (Validated for IHC, WB, 0.05 mg/ml)

Polyclonal Anti-IDH1 Antibody (Validated for IHC, WB, 0.05 mg/ml)

CAT#: ATB-G006

Inquiry

Overview Specification

Unit Size	100 μl, 25 μl
Concentration	0.05 mg/ml
Availability	>10 in stock
Recommended Applications	IHC, WB
Keywords	100 μl, 25 μl; 0.05 mg/ml; IHC, WB

Product Description	Polyclonal antibody against human IDH1
Target Protein	Isocitrate dehydrogenase 1 (NADP+), soluble
Target Gene	IDH1
Antigen Sequence	LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
Verified Species Reactivity	Human
Interspecies Information	Highest antigen sequence identity to the following orthologs: Rat ENSRNOG00000015020 (95%) Mouse ENSMUSG00000025950 (92%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Shipping	Normally shipped at ambient temperature.
Storage	Store at +4℃ for short term storage. Long time storage is recommended at -20℃.

All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Online Inquiry

Alfa Cytology provides its clients with one-stop solutions to accelerate therapeutic discovery and development of brain tumors.

By Disease

Craniopharyngioma

Schwannoma (neuroma)

Pituitary Tumors

Choroid Plexus Tumors

By Molecule Type

Small Molecule Drug

Therapeutic Antibody

Immune Cell Therapy

Oncolytic Virotherapy

Vaccine Development

Contact Us

Copyright © 2024 Alfa Cytology. All rights reserved.